Parasite LDBPK_361420 protein
Catalog Number:
BYT-ORB604479
- Images (3)
| Article Name: | Parasite LDBPK_361420 protein |
| Biozol Catalog Number: | BYT-ORB604479 |
| Supplier Catalog Number: | orb604479 |
| Alternative Catalog Number: | BYT-ORB604479-1,BYT-ORB604479-100,BYT-ORB604479-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | / |
| This Parasite LDBPK_361420 protein spans the amino acid sequence from region 15-98aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molecular Weight: | 13.7 kDa |
| UniProt: | E9BTK1 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Leishmania donovani (strain BPK282A1) |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | NKLIVEEPYNDDNSVVSLNPKRMEELNIFRGDTVLVKGKKHRSTVCIAMEDDECPPEKIKMNKVARRNIRIHLGDTIRIAPCKD |
| Application Notes: | Biological Origin: Leishmania donovani (strain BPK282A1). Application Notes: Partial |



