Virus aur protein
Catalog Number:
BYT-ORB604521
- Images (3)
| Article Name: | Virus aur protein |
| Biozol Catalog Number: | BYT-ORB604521 |
| Supplier Catalog Number: | orb604521 |
| Alternative Catalog Number: | BYT-ORB604521-1,BYT-ORB604521-100,BYT-ORB604521-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Staphylococcus aureus neutral proteinase |
| This Virus aur protein spans the amino acid sequence from region 210-509aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molecular Weight: | 40.7 kDa |
| UniProt: | P81177 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Staphylococcus aureus |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | AATGTGKGVLGDTKDININSIDGGFSLEDLTHQGKLSAYNFNDQTGQATLITNEDENFVKDDQRAGVDANYYAKQTYDYYKNTFGRESYDNHGSPIVSLTHVNHYGGQDNRNNAAWIGDKMIYGDGDGRTFTNLSGANDVVAHELTHGVTQETANLEYKDQSGALNESFSDVFGYFVDDEDFLMGEDVYTPGKEGDALRSMSNPEQFGQPSHMKDYVYTEKDNGGVHTNSGIPNKAAYNVIQAIGKSKSEQIYYR |
| Application Notes: | Biological Origin: Staphylococcus aureus. Application Notes: Full Length of Mature Protein |



