Virus aur protein

Catalog Number: BYT-ORB604521
Article Name: Virus aur protein
Biozol Catalog Number: BYT-ORB604521
Supplier Catalog Number: orb604521
Alternative Catalog Number: BYT-ORB604521-1,BYT-ORB604521-100,BYT-ORB604521-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Staphylococcus aureus neutral proteinase
This Virus aur protein spans the amino acid sequence from region 210-509aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 40.7 kDa
UniProt: P81177
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Staphylococcus aureus
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: AATGTGKGVLGDTKDININSIDGGFSLEDLTHQGKLSAYNFNDQTGQATLITNEDENFVKDDQRAGVDANYYAKQTYDYYKNTFGRESYDNHGSPIVSLTHVNHYGGQDNRNNAAWIGDKMIYGDGDGRTFTNLSGANDVVAHELTHGVTQETANLEYKDQSGALNESFSDVFGYFVDDEDFLMGEDVYTPGKEGDALRSMSNPEQFGQPSHMKDYVYTEKDNGGVHTNSGIPNKAAYNVIQAIGKSKSEQIYYR
Application Notes: Biological Origin: Staphylococcus aureus. Application Notes: Full Length of Mature Protein
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureusaur.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Staphylococcus aureusaur.
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.