Virus L protein
Catalog Number:
BYT-ORB604544
- Images (3)
| Article Name: | Virus L protein |
| Biozol Catalog Number: | BYT-ORB604544 |
| Supplier Catalog Number: | orb604544 |
| Alternative Catalog Number: | BYT-ORB604544-1,BYT-ORB604544-100,BYT-ORB604544-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | Large structural protein Replicase Transcriptase |
| This Virus L protein spans the amino acid sequence from region 625-809aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molecular Weight: | 24.9 kDa |
| UniProt: | Q05318 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus) |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | RGSSFVTDLEKYNLAFRYEFTAPFIEYCNRCYGVKNVFNWMHYTIPQCYMHVSDYYNPPHNLTLENRDNPPEGPSSYRGHMGGIEGLQQKLWTSISCAQISLVEIKTGFKLRSAVMGDNQCITVLSVFPLETDADEQEQSAEDNAARVAASLAKVTSACGIFLKPDETFVHSGFIYFGKKQYLNG |
| Application Notes: | Biological Origin: Zaire ebolavirus (strain Mayinga-76) (ZEBOV) (Zaire Ebola virus). Application Notes: Partial |



