Human HEATR6 protein

Catalog Number: BYT-ORB604973
Article Name: Human HEATR6 protein
Biozol Catalog Number: BYT-ORB604973
Supplier Catalog Number: orb604973
Alternative Catalog Number: BYT-ORB604973-1,BYT-ORB604973-100,BYT-ORB604973-20
Manufacturer: Biorbyt
Category: Proteine/Peptide
Alternative Names: Amplified in breast cancer protein 1 ABC1
This Human HEATR6 protein spans the amino acid sequence from region 1052-1175aa. Purity: Greater than 85% as determined by SDS-PAGE.
Molecular Weight: 18.5 kDa
UniProt: Q6AI08
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Source: Homo sapiens (Human)
Purity: Greater than 85% as determined by SDS-PAGE.
Form: Liquid or Lyophilized powder
Sequence: KSEDTIDFLEFKYCVSLRTQICQALIHLLSLASASDLPCMKETLELSGNMVQSYILQFLKSGAEGDDTGAPHSPQERDQMVRMALKHMGSIQAPTGDTARRAIMGFLEEILAVCFDSSGSQGAL
Application Notes: Biological Origin: Homo sapiens (Human). Application Notes: Partial
(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HEATR6.
Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HEATR6.