Mouse Il31ra protein
Catalog Number:
BYT-ORB605045
- Images (3)
| Article Name: | Mouse Il31ra protein |
| Biozol Catalog Number: | BYT-ORB605045 |
| Supplier Catalog Number: | orb605045 |
| Alternative Catalog Number: | BYT-ORB605045-1,BYT-ORB605045-100,BYT-ORB605045-20 |
| Manufacturer: | Biorbyt |
| Category: | Proteine/Peptide |
| Alternative Names: | GLM-R (mGLM-R) (Gp130-like monocyte receptor) (Gp130-like receptor) (Novel cytokine receptor 10) (NR10) (ZcytoR17) (Glmr) |
| This Mouse Il31ra protein spans the amino acid sequence from region 19-499aa. Purity: Greater than 85% as determined by SDS-PAGE. |
| Molecular Weight: | 59.2 kDa |
| UniProt: | Q8K5B1 |
| Buffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Source: | Mus musculus (Mouse) |
| Purity: | Greater than 85% as determined by SDS-PAGE. |
| Form: | Liquid or Lyophilized powder |
| Sequence: | VLPTKPENISCVFYFDRNLTCTWRPEKETNDTSYIVTLTYSYGKSNYSDNATEASYSFPRSCAMPPDICSVEVQAQNGDGKVKSDITYWHLISIAKTEPPIILSVNPICNRMFQIQWKPREKTRGFPLVCMLRFRTVNSSHWTEVNFENCKQVCNLTGLQAFTEYVLALRFRFNDSRYWSKWSKEETRVTMEEVPHVLDLWRILEPADMNGDRKVRLLWKKARGAPVLEKTFGYHIQYFAENSTNLTEINNITTQ |
| Application Notes: | Biological Origin: Mus musculus (Mouse). Application Notes: Extracellular Domain |



