Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9.
Alternative Names:
Growth/differentiation factor 9, GDF-9, GDF9
GDF9 is a member of the bone morphogenetic protein (BMP) family and the TGF-beta superfamily. This group of proteins is characterized by a polybasic proteolytic processing site which is cleaved to produce a mature protein containing seven conserved cysteine residues. The members of this family are regulators of cell growth and differentiation in both embryonic and adult tissues. Growth factors synthesized by ovarian somatic cells directly affect oocyte growth and function. GDF9 is expressed in oocytes and is thought to be required for ovarian folliculogenesis. GDF9/4261 can be used in assays to detect oocyte expression and has been shown to neutralize GDF9 biological activity.
200ug/ml of Ab purified from Bioreactor Concentrate by Protein A/G. Prepared in 10mM PBS with 0.05% BSA & 0.05% azide. Also available WITHOUT BSA & azide at 1.0mg/ml.
Antibody Type:
Monoclonal Antibody
Application Notes:
ELISA (For coating, order antibody without BSA), Western Blot (1-2ug/ml), ,Immunohistochemistry (Formalin-fixed) (1-2ug/ml for 30 minutes at RT),(Staining of formalin-fixed tissues requires heating tissue sections in 10mM Tris with 1mM EDTA, pH 9.0, for
SDS-PAGE Analysis of Purified GDF9 Mouse Monoclonal Antibody (GDF9/4261) Confirmation of Integrity and Purity of Antibody.
Formalin-fixed, paraffin-embedded human ovary stained with GDF9 Mouse Monoclonal Antibody (GDF9/4261).
* VAT and and shipping costs not included. Errors and price changes excepted
