Monocyte Chemotactic Protein-4, Human Recombinant (CCL13)
Catalog Number:
RAY-228-11085-2
- Images (0)
| Article Name: | Monocyte Chemotactic Protein-4, Human Recombinant (CCL13) |
| Biozol Catalog Number: | RAY-228-11085-2 |
| Supplier Catalog Number: | 228-11085-2 |
| Alternative Catalog Number: | RAY-228-11085-2 |
| Manufacturer: | RayBiotech |
| Category: | Proteine/Peptide |
| Species Reactivity: | Human |
| Alternative Names: | Small inducible cytokine A13, CCL13, Monocyte chemotactic protein 4, MCP-4, Monocyte chemoattractant protein 4, CK-beta-10, NCC-1, chemokine (C-C motif) ligand 13, NCC1, CKb10, SCYL1, SCYA13, MGC17134. |
| NCBI: | 6357 |
| Expression System: | E. coli |
| Purity: | Greater than 96.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Form: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequence: | QPDALNVPSTCCFTFSSKKISLQRLKSYVITTSRCPQKAVIFRTKLGKEICADPKEKWVQNYMKHLGRKAHTLKT. |
| Formula: | The protein was lyophilized from a concentrated (1mg/ml) sterile solution in 20mM PB, pH 7.4, 130mM NaCl. |
Product Guarantee and Expert Support
