Macrophage Inflammatory Protein-5, Human Recombinant (CCL15)
Catalog Number:
RAY-228-11124-2
- Images (0)
| Article Name: | Macrophage Inflammatory Protein-5, Human Recombinant (CCL15) |
| Biozol Catalog Number: | RAY-228-11124-2 |
| Supplier Catalog Number: | 228-11124-2 |
| Alternative Catalog Number: | RAY-228-11124-2 |
| Manufacturer: | RayBiotech |
| Category: | Proteine/Peptide |
| Species Reactivity: | Human |
| Alternative Names: | Small inducible cytokine A15 precursor, CCL15, Macrophage inflammatory protein 5, MIP-5, MIP5, Chemokine CC-2, HCC-2, NCC-3, MIP- 1 delta, Leukotactin-1, LKN-1, Mrp-2b, C-C motif chemokine 15. |
| NCBI: | 6359 |
| Expression System: | E. coli |
| Purity: | Greater than 97.0% as determined by:(a) Analysis by RP-HPLC.(b) Analysis by SDS-PAGE. |
| Form: | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Sequence: | QFINDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKP GVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI. |
| Formula: | MIP5 was lyophilized from a concentrated (1mg/ml) solution containing 20mM PBS pH-7.4 and 100mM NaCl. |
Product Guarantee and Expert Support
