GUCY2F Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14242
Artikelname: GUCY2F Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14242
Hersteller Artikelnummer: A14242
Alternativnummer: ABB-A14242-20UL,ABB-A14242-100UL,ABB-A14242-500UL,ABB-A14242-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CYGF, GC-F, GUC2F, GUC2DL, RETGC-2, ROS-GC2, GUCY2F
The protein encoded by this gene is a guanylyl cyclase found predominantly in photoreceptors in the retina. The encoded protein is thought to be involved in resynthesis of cGMP after light activation of the visual signal transduction cascade, allowing a return to the dark state. This protein is a single-pass type I membrane protein. Defects in this gene may be a cause of X-linked retinitis pigmentosa.
Klonalität: Polyclonal
Molekulargewicht: 125kDa
NCBI: 2986
UniProt: P51841
Reinheit: Affinity purification
Sequenz: HSALIGGETQMHLLECAHDLKMTDGTYVFVPYDALLYSLPYKHTPYRVLRNNPKLREAYDAVLTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIAQAMNNAMKENGQAGAASLVQHSRNMQFHGFNQLMRTDSNGNGISEYVILDTNLKEWELHSTYTVDMEMELLRFGGTPIHFPGGRPPRADAKCWFAEGKIC
Target-Kategorie: GUCY2F
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag
Western blot analysis of lysates from mouse eye, using GUCY2F Rabbit pAb (A14242) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.