GUCY2F Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A14242
- Images (1)
| Article Name: | GUCY2F Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A14242 |
| Supplier Catalog Number: | A14242 |
| Alternative Catalog Number: | ABB-A14242-20UL,ABB-A14242-100UL,ABB-A14242-500UL,ABB-A14242-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CYGF, GC-F, GUC2F, GUC2DL, RETGC-2, ROS-GC2, GUCY2F |
| The protein encoded by this gene is a guanylyl cyclase found predominantly in photoreceptors in the retina. The encoded protein is thought to be involved in resynthesis of cGMP after light activation of the visual signal transduction cascade, allowing a return to the dark state. This protein is a single-pass type I membrane protein. Defects in this gene may be a cause of X-linked retinitis pigmentosa. |
| Clonality: | Polyclonal |
| Molecular Weight: | 125kDa |
| NCBI: | 2986 |
| UniProt: | P51841 |
| Purity: | Affinity purification |
| Sequence: | HSALIGGETQMHLLECAHDLKMTDGTYVFVPYDALLYSLPYKHTPYRVLRNNPKLREAYDAVLTITVESQEKTFYQAFTEAAARGEIPEKLEFDQVSPLFGTIYNSIYFIAQAMNNAMKENGQAGAASLVQHSRNMQFHGFNQLMRTDSNGNGISEYVILDTNLKEWELHSTYTVDMEMELLRFGGTPIHFPGGRPPRADAKCWFAEGKIC |
| Target: | GUCY2F |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction. Shipping: Ice Bag |
|
|
Western blot analysis of lysates from mouse eye, using GUCY2F Rabbit pAb (A14242) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 90s. |
Product Guarantee and Expert Support
