CHMP7 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A14360
- Bilder (1)
| Artikelname: | CHMP7 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A14360 |
| Hersteller Artikelnummer: | A14360 |
| Alternativnummer: | ABB-A14360-100UL,ABB-A14360-20UL,ABB-A14360-1000UL,ABB-A14360-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CHMP7 |
| Involved in several processes, including late endosome to vacuole transport, midbody abscission, and mitotic nuclear division. Located in cytosol, nuclear envelope, and nucleoplasm. Part of ESCRT III complex. Colocalizes with chromatin. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 51kDa |
| NCBI: | 91782 |
| UniProt: | Q8WUX9 |
| Reinheit: | Affinity purification |
| Sequenz: | KVSPVNDVDVGVYQLMQSEQLLSRKVESLSQEAERCKEEARRACRAGKKQLALRSLKAKQRTEKRIEALHAKLDTVQGILDRIYASQTDQMVFNAYQAGVGALKLSMKDVTVEKAESLVDQIQELCDTQDEVSQTLAGGVTNGLDFDSEELEKELDILLQDTTKEPLDLPDNPRNRHFTNSVPNPRISDAELEAELEKLSLSEGGLVPSSKSPKRQLEPTLKPL |
| Target-Kategorie: | CHMP7 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Autophagy. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CHMP7 Rabbit pAb (A14360) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Produktgarantie und fachkundiger Support
