CHMP7 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A14360
- Images (1)
| Article Name: | CHMP7 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A14360 |
| Supplier Catalog Number: | A14360 |
| Alternative Catalog Number: | ABB-A14360-100UL,ABB-A14360-20UL,ABB-A14360-1000UL,ABB-A14360-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CHMP7 |
| Involved in several processes, including late endosome to vacuole transport, midbody abscission, and mitotic nuclear division. Located in cytosol, nuclear envelope, and nucleoplasm. Part of ESCRT III complex. Colocalizes with chromatin. |
| Clonality: | Polyclonal |
| Molecular Weight: | 51kDa |
| NCBI: | 91782 |
| UniProt: | Q8WUX9 |
| Purity: | Affinity purification |
| Sequence: | KVSPVNDVDVGVYQLMQSEQLLSRKVESLSQEAERCKEEARRACRAGKKQLALRSLKAKQRTEKRIEALHAKLDTVQGILDRIYASQTDQMVFNAYQAGVGALKLSMKDVTVEKAESLVDQIQELCDTQDEVSQTLAGGVTNGLDFDSEELEKELDILLQDTTKEPLDLPDNPRNRHFTNSVPNPRISDAELEAELEKLSLSEGGLVPSSKSPKRQLEPTLKPL |
| Target: | CHMP7 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Autophagy. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CHMP7 Rabbit pAb (A14360) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 10s. |
Product Guarantee and Expert Support
