KCNJ12 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14375
Artikelname: KCNJ12 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14375
Hersteller Artikelnummer: A14375
Alternativnummer: ABB-A14375-100UL,ABB-A14375-20UL,ABB-A14375-1000UL,ABB-A14375-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: IRK2, hIRK, IRK-2, hIRK1, KCNJN1, Kir2.2, kcnj12x, hkir2.2x, KCNJ12
This gene encodes an inwardly rectifying K+ channel which may be blocked by divalent cations. This protein is thought to be one of multiple inwardly rectifying channels which contribute to the cardiac inward rectifier current (IK1). The gene is located within the Smith-Magenis syndrome region on chromosome 17.
Klonalität: Polyclonal
Molekulargewicht: 49kDa
NCBI: 3768
UniProt: Q14500
Reinheit: Affinity purification
Sequenz: TPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI
Target-Kategorie: KCNJ12
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using KCNJ12 Rabbit pAb (A14375) at 1:300 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.