KCNJ12 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14375
Article Name: KCNJ12 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14375
Supplier Catalog Number: A14375
Alternative Catalog Number: ABB-A14375-100UL,ABB-A14375-20UL,ABB-A14375-1000UL,ABB-A14375-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: IRK2, hIRK, IRK-2, hIRK1, KCNJN1, Kir2.2, kcnj12x, hkir2.2x, KCNJ12
This gene encodes an inwardly rectifying K+ channel which may be blocked by divalent cations. This protein is thought to be one of multiple inwardly rectifying channels which contribute to the cardiac inward rectifier current (IK1). The gene is located within the Smith-Magenis syndrome region on chromosome 17.
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 3768
UniProt: Q14500
Purity: Affinity purification
Sequence: TPRCSAKDLVENKFLLPSANSFCYENELAFLSRDEEDEADGDQDGRSRDGLSPQARHDFDRLQAGGGVLEQRPYRRESEI
Target: KCNJ12
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. Shipping: Ice Bag
Western blot analysis of various lysates using KCNJ12 Rabbit pAb (A14375) at 1:300 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.