G2E3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A14410
- Bilder (1)
| Artikelname: | G2E3 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A14410 |
| Hersteller Artikelnummer: | A14410 |
| Alternativnummer: | ABB-A14410-20UL,ABB-A14410-100UL,ABB-A14410-500UL,ABB-A14410-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | PHF7B, KIAA1333, G2E3 |
| Predicted to enable ubiquitin protein ligase activity. Predicted to be involved in apoptotic process and protein ubiquitination. Predicted to act upstream of or within blastocyst development, negative regulation of intrinsic apoptotic signaling pathway, and protein polyubiquitination. Located in Golgi apparatus and cytosol. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 81kDa |
| NCBI: | 55632 |
| UniProt: | Q7L622 |
| Reinheit: | Affinity purification |
| Sequenz: | MNESKPGDSQNLACVFCRKHDDCPNKYGEKKTKEKWNLTVHYYCLLMSSGIWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKRSYHFPCGLQRECIFQFTGNFASFCWDHRPVQIITSNNYRESLPCTICLEFIEPIPSYNILRSPCCKNAWFHRDCLQVQAI |
| Target-Kategorie: | G2E3 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Ubiquitin. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using G2E3 Rabbit pAb (A14410) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Produktgarantie und fachkundiger Support
