G2E3 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A14410
- Images (1)
| Article Name: | G2E3 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A14410 |
| Supplier Catalog Number: | A14410 |
| Alternative Catalog Number: | ABB-A14410-20UL,ABB-A14410-100UL,ABB-A14410-500UL,ABB-A14410-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | PHF7B, KIAA1333, G2E3 |
| Predicted to enable ubiquitin protein ligase activity. Predicted to be involved in apoptotic process and protein ubiquitination. Predicted to act upstream of or within blastocyst development, negative regulation of intrinsic apoptotic signaling pathway, and protein polyubiquitination. Located in Golgi apparatus and cytosol. |
| Clonality: | Polyclonal |
| Molecular Weight: | 81kDa |
| NCBI: | 55632 |
| UniProt: | Q7L622 |
| Purity: | Affinity purification |
| Sequence: | MNESKPGDSQNLACVFCRKHDDCPNKYGEKKTKEKWNLTVHYYCLLMSSGIWQRGKEEEGVYGFLIEDIRKEVNRASKLKCCVCKKNGASIGCVAPRCKRSYHFPCGLQRECIFQFTGNFASFCWDHRPVQIITSNNYRESLPCTICLEFIEPIPSYNILRSPCCKNAWFHRDCLQVQAI |
| Target: | G2E3 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Ubiquitin. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using G2E3 Rabbit pAb (A14410) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Product Guarantee and Expert Support
