PSD2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A14429
- Bilder (1)
| Artikelname: | PSD2 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A14429 |
| Hersteller Artikelnummer: | A14429 |
| Alternativnummer: | ABB-A14429-100UL,ABB-A14429-20UL,ABB-A14429-1000UL,ABB-A14429-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | EFA6C, PSD2 |
| Predicted to enable guanyl-nucleotide exchange factor activity and phospholipid binding activity. Predicted to be involved in regulation of ARF protein signal transduction and regulation of catalytic activity. Predicted to be located in cleavage furrow and ruffle membrane. Predicted to be active in glutamatergic synapse and postsynapse. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 85kDa |
| NCBI: | 84249 |
| UniProt: | Q9BQI7 |
| Reinheit: | Affinity purification |
| Sequenz: | MEEDKLLSAVPEEGDATRDPGPEPEEEPGVRNGMASEGLNSSLCSPGHERRGTPADTEEPTKDPDVAFHGLSLGLSLTNGLALGPDLNILEDSAESRPWRAGVLAEGDNASRSLYPDAEDPQLGLDGPGEPDVRDGFSATFEKILESELLRGTQYSSLDSLDGLSLTDESDSCVSFEAPLTPLIQQRARD |
| Target-Kategorie: | PSD2 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using PSD2 Rabbit pAb (A14429) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 5s. |
Produktgarantie und fachkundiger Support
