PSD2 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A14429
- Images (1)
| Article Name: | PSD2 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A14429 |
| Supplier Catalog Number: | A14429 |
| Alternative Catalog Number: | ABB-A14429-100UL,ABB-A14429-20UL,ABB-A14429-1000UL,ABB-A14429-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | EFA6C, PSD2 |
| Predicted to enable guanyl-nucleotide exchange factor activity and phospholipid binding activity. Predicted to be involved in regulation of ARF protein signal transduction and regulation of catalytic activity. Predicted to be located in cleavage furrow and ruffle membrane. Predicted to be active in glutamatergic synapse and postsynapse. |
| Clonality: | Polyclonal |
| Molecular Weight: | 85kDa |
| NCBI: | 84249 |
| UniProt: | Q9BQI7 |
| Purity: | Affinity purification |
| Sequence: | MEEDKLLSAVPEEGDATRDPGPEPEEEPGVRNGMASEGLNSSLCSPGHERRGTPADTEEPTKDPDVAFHGLSLGLSLTNGLALGPDLNILEDSAESRPWRAGVLAEGDNASRSLYPDAEDPQLGLDGPGEPDVRDGFSATFEKILESELLRGTQYSSLDSLDGLSLTDESDSCVSFEAPLTPLIQQRARD |
| Target: | PSD2 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse,Rat. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using PSD2 Rabbit pAb (A14429) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 5s. |
Product Guarantee and Expert Support
