NCR1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14499
Artikelname: NCR1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14499
Hersteller Artikelnummer: A14499
Alternativnummer: ABB-A14499-100UL,ABB-A14499-20UL,ABB-A14499-1000UL,ABB-A14499-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: LY94, CD335, NKP46, NK-p46, NCR1
Predicted to be involved in cellular defense response, regulation of natural killer cell mediated cytotoxicity, and signal transduction. Predicted to act upstream of or within defense response to virus and detection of virus. Predicted to be located in cell surface. Predicted to be part of SWI/SNF complex. Predicted to be active in plasma membrane. Biomarker of acquired immunodeficiency syndrome, anogenital venereal wart, hepatitis C, and lymphoproliferative syndrome.
Klonalität: Polyclonal
Molekulargewicht: 34kDa
NCBI: 9437
UniProt: O76036
Reinheit: Affinity purification
Sequenz: SMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPDTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL
Target-Kategorie: NCR1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation,CDs. Shipping: Ice Bag
Western blot analysis of lysates from Rat spleen, using NCR1 Rabbit pAb (A14499) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.