NCR1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14499
Article Name: NCR1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14499
Supplier Catalog Number: A14499
Alternative Catalog Number: ABB-A14499-100UL,ABB-A14499-20UL,ABB-A14499-1000UL,ABB-A14499-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: LY94, CD335, NKP46, NK-p46, NCR1
Predicted to be involved in cellular defense response, regulation of natural killer cell mediated cytotoxicity, and signal transduction. Predicted to act upstream of or within defense response to virus and detection of virus. Predicted to be located in cell surface. Predicted to be part of SWI/SNF complex. Predicted to be active in plasma membrane. Biomarker of acquired immunodeficiency syndrome, anogenital venereal wart, hepatitis C, and lymphoproliferative syndrome.
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 9437
UniProt: O76036
Purity: Affinity purification
Sequence: SMFLLLKEGRSSHVQRGYGKVQAEFPLGPVTTAHRGTYRCFGSYNNHAWSFPSEPVKLLVTGDIENTSLAPEDPTFPDTWGTYLLTTETGLQKDHALWDHTAQNLLRMGLAFLVLVALVWFLVEDWLSRKRTRERASRASTWEGRRRLNTQTL
Target: NCR1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Apoptosis,Immunology Inflammation,CDs. Shipping: Ice Bag
Western blot analysis of lysates from Rat spleen, using NCR1 Rabbit pAb (A14499) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.