RBX1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14500
Artikelname: RBX1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14500
Hersteller Artikelnummer: A14500
Alternativnummer: ABB-A14500-100UL,ABB-A14500-20UL,ABB-A14500-500UL,ABB-A14500-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: ROC1, RNF75, BA554C12.1, RBX1
This locus encodes a RING finger-like domain-containing protein. The encoded protein interacts with cullin proteins and likely plays a role in ubiquitination processes necessary for cell cycle progression. This protein may also affect protein turnover. Related pseudogenes exist on chromosomes 2 and 5.
Klonalität: Polyclonal
Molekulargewicht: 12kDa
NCBI: 9978
UniProt: P62877
Reinheit: Affinity purification
Sequenz: MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNRE
Target-Kategorie: RBX1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway,Immunology Inflammation,Cardiovascular,Angiogenesis. Shipping: Ice Bag
Western blot analysis of various lysates using RBX1 Rabbit pAb (A14500) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.