RBX1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14500
Article Name: RBX1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14500
Supplier Catalog Number: A14500
Alternative Catalog Number: ABB-A14500-100UL,ABB-A14500-20UL,ABB-A14500-500UL,ABB-A14500-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: ROC1, RNF75, BA554C12.1, RBX1
This locus encodes a RING finger-like domain-containing protein. The encoded protein interacts with cullin proteins and likely plays a role in ubiquitination processes necessary for cell cycle progression. This protein may also affect protein turnover. Related pseudogenes exist on chromosomes 2 and 5.
Clonality: Polyclonal
Molecular Weight: 12kDa
NCBI: 9978
UniProt: P62877
Purity: Affinity purification
Sequence: MAAAMDVDTPSGTNSGAGKKRFEVKKWNAVALWAWDIVVDNCAICRNHIMDLCIECQANQASATSEECTVAWGVCNHAFHFHCISRWLKTRQVCPLDNRE
Target: RBX1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Signal Transduction,Cell Biology Developmental Biology,Ubiquitin,Ubiquitin-Proteasome Signaling Pathway,Immunology Inflammation,Cardiovascular,Angiogenesis. Shipping: Ice Bag
Western blot analysis of various lysates using RBX1 Rabbit pAb (A14500) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.