TPH2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14520
Artikelname: TPH2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14520
Hersteller Artikelnummer: A14520
Alternativnummer: ABB-A14520-100UL,ABB-A14520-20UL,ABB-A14520-500UL,ABB-A14520-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: NTPH, ADHD7, TPH2
This gene encodes a member of the pterin-dependent aromatic acid hydroxylase family. The encoded protein catalyzes the first and rate limiting step in the biosynthesis of serotonin, an important hormone and neurotransmitter. Mutations in this gene may be associated with psychiatric diseases such as bipolar affective disorder and major depression.
Klonalität: Polyclonal
Molekulargewicht: 56kDa
NCBI: 121278
UniProt: Q8IWU9
Reinheit: Affinity purification
Sequenz: FDPKTTCLQECLITTFQEAYFVSESFEEAKEKMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQD
Target-Kategorie: TPH2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates, using TPH2 Rabbit pAb (A14520) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.