TPH2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14520
Article Name: TPH2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14520
Supplier Catalog Number: A14520
Alternative Catalog Number: ABB-A14520-100UL,ABB-A14520-20UL,ABB-A14520-500UL,ABB-A14520-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: NTPH, ADHD7, TPH2
This gene encodes a member of the pterin-dependent aromatic acid hydroxylase family. The encoded protein catalyzes the first and rate limiting step in the biosynthesis of serotonin, an important hormone and neurotransmitter. Mutations in this gene may be associated with psychiatric diseases such as bipolar affective disorder and major depression.
Clonality: Polyclonal
Molecular Weight: 56kDa
NCBI: 121278
UniProt: Q8IWU9
Purity: Affinity purification
Sequence: FDPKTTCLQECLITTFQEAYFVSESFEEAKEKMRDFAKSITRPFSVYFNPYTQSIEILKDTRSIENVVQD
Target: TPH2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates, using TPH2 Rabbit pAb (A14520) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.