TOMM22 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14548
Artikelname: TOMM22 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14548
Hersteller Artikelnummer: A14548
Alternativnummer: ABB-A14548-100UL,ABB-A14548-20UL,ABB-A14548-1000UL,ABB-A14548-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: 1C9-2, TOM22, MST065, MSTP065, TOMM22
The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion.
Klonalität: Polyclonal
Molekulargewicht: 16kDa
NCBI: 56993
UniProt: Q9NS69
Reinheit: Affinity purification
Sequenz: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRA
Target-Kategorie: TOMM22
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using TOMM22 Rabbit pAb (A14548) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.