TOMM22 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14548
Article Name: TOMM22 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14548
Supplier Catalog Number: A14548
Alternative Catalog Number: ABB-A14548-100UL,ABB-A14548-20UL,ABB-A14548-1000UL,ABB-A14548-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: 1C9-2, TOM22, MST065, MSTP065, TOMM22
The protein encoded by this gene is an integral membrane protein of the mitochondrial outer membrane. The encoded protein interacts with TOMM20 and TOMM40, and forms a complex with several other proteins to import cytosolic preproteins into the mitochondrion.
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 56993
UniProt: Q9NS69
Purity: Affinity purification
Sequence: MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLSLFVAQKMYRFSRA
Target: TOMM22
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Signal Transduction,Endocrine Metabolism,Mitochondrial metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using TOMM22 Rabbit pAb (A14548) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.