EFNB1 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14562
Artikelname: EFNB1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14562
Hersteller Artikelnummer: A14562
Alternativnummer: ABB-A14562-20UL,ABB-A14562-100UL,ABB-A14562-1000UL,ABB-A14562-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: CFND, CFNS, EFB1, EFL3, EPLG2, Elk-L, LERK2, EFNB1
The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system.
Klonalität: Polyclonal
Molekulargewicht: 38kDa
NCBI: 1947
UniProt: P98172
Reinheit: Affinity purification
Sequenz: TVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Target-Kategorie: EFNB1
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse. ResearchArea: Signal Transduction,Kinase,Tyrosine kinases,Cell Biology Developmental Biology,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from mouse brain, using EFNB1 Rabbit pAb (A14562) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.