EFNB1 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14562
Article Name: EFNB1 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14562
Supplier Catalog Number: A14562
Alternative Catalog Number: ABB-A14562-20UL,ABB-A14562-100UL,ABB-A14562-1000UL,ABB-A14562-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: CFND, CFNS, EFB1, EFL3, EPLG2, Elk-L, LERK2, EFNB1
The protein encoded by this gene is a type I membrane protein and a ligand of Eph-related receptor tyrosine kinases. It may play a role in cell adhesion and function in the development or maintenance of the nervous system.
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 1947
UniProt: P98172
Purity: Affinity purification
Sequence: TVLLLKLRKRHRKHTQQRAAALSLSTLASPKGGSGTAGTEPSDIIIPLRTTENNYCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV
Target: EFNB1
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse. ResearchArea: Signal Transduction,Kinase,Tyrosine kinases,Cell Biology Developmental Biology,Neuroscience. Shipping: Ice Bag
Western blot analysis of lysates from mouse brain, using EFNB1 Rabbit pAb (A14562) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.