PHC2 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14610
Artikelname: PHC2 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14610
Hersteller Artikelnummer: A14610
Alternativnummer: ABB-A14610-20UL,ABB-A14610-100UL,ABB-A14610-500UL,ABB-A14610-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PH2, EDR2, HPH2, PHC2
In Drosophila melanogaster, the Polycomb group (PcG) of genes are part of a cellular memory system that is responsible for the stable inheritance of gene activity. PcG proteins form a large multimeric, chromatin-associated protein complex. The protein encoded by this gene has homology to the Drosophila PcG protein polyhomeotic (Ph) and is known to heterodimerize with EDR1 and colocalize with BMI1 in interphase nuclei of human cells. The specific function in human cells has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 91kDa
NCBI: 1912
UniProt: Q8IXK0
Reinheit: Affinity purification
Sequenz: HFLPSEPTKWNVEDVYEFIRSLPGCQEIAEEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKIYARISMLKDS
Target-Kategorie: PHC2
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Chromatin Remodeling. Shipping: Ice Bag
Western blot analysis of various lysates using PHC2 Rabbit pAb (A14610) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.