PHC2 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14610
Article Name: PHC2 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14610
Supplier Catalog Number: A14610
Alternative Catalog Number: ABB-A14610-20UL,ABB-A14610-100UL,ABB-A14610-500UL,ABB-A14610-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PH2, EDR2, HPH2, PHC2
In Drosophila melanogaster, the Polycomb group (PcG) of genes are part of a cellular memory system that is responsible for the stable inheritance of gene activity. PcG proteins form a large multimeric, chromatin-associated protein complex. The protein encoded by this gene has homology to the Drosophila PcG protein polyhomeotic (Ph) and is known to heterodimerize with EDR1 and colocalize with BMI1 in interphase nuclei of human cells. The specific function in human cells has not yet been determined. Two transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 91kDa
NCBI: 1912
UniProt: Q8IXK0
Purity: Affinity purification
Sequence: HFLPSEPTKWNVEDVYEFIRSLPGCQEIAEEFRAQEIDGQALLLLKEDHLMSAMNIKLGPALKIYARISMLKDS
Target: PHC2
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human. ResearchArea: Epigenetics Nuclear Signaling,Chromatin Remodeling. Shipping: Ice Bag
Western blot analysis of various lysates using PHC2 Rabbit pAb (A14610) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.