Dopamine Receptor D3 (DRD3) Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14622
Artikelname: Dopamine Receptor D3 (DRD3) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14622
Hersteller Artikelnummer: A14622
Alternativnummer: ABB-A14622-20UL,ABB-A14622-100UL,ABB-A14622-1000UL,ABB-A14622-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: D3DR, ETM1, FET1, Dopamine Receptor D3 (DRD3)
This gene encodes the D3 subtype of the five (D1-D5) dopamine receptors. The activity of the D3 subtype receptor is mediated by G proteins which inhibit adenylyl cyclase. This receptor is localized to the limbic areas of the brain, which are associated with cognitive, emotional, and endocrine functions. Genetic variation in this gene may be associated with susceptibility to hereditary essential tremor 1. Alternative splicing of this gene results in transcript variants encoding different isoforms, although some variants may be subject to nonsense-mediated decay (NMD).
Klonalität: Polyclonal
Molekulargewicht: 44kDa
NCBI: 1814
UniProt: P35462
Reinheit: Affinity purification
Sequenz: MASLSQLSGHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSR
Target-Kategorie: DRD3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Mouse,Rat. ResearchArea: Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using Dopamine Receptor D3 (DRD3) Rabbit pAb (A14622) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.