Dopamine Receptor D3 (DRD3) Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14622
Article Name: Dopamine Receptor D3 (DRD3) Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14622
Supplier Catalog Number: A14622
Alternative Catalog Number: ABB-A14622-20UL,ABB-A14622-100UL,ABB-A14622-1000UL,ABB-A14622-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: D3DR, ETM1, FET1, Dopamine Receptor D3 (DRD3)
This gene encodes the D3 subtype of the five (D1-D5) dopamine receptors. The activity of the D3 subtype receptor is mediated by G proteins which inhibit adenylyl cyclase. This receptor is localized to the limbic areas of the brain, which are associated with cognitive, emotional, and endocrine functions. Genetic variation in this gene may be associated with susceptibility to hereditary essential tremor 1. Alternative splicing of this gene results in transcript variants encoding different isoforms, although some variants may be subject to nonsense-mediated decay (NMD).
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 1814
UniProt: P35462
Purity: Affinity purification
Sequence: MASLSQLSGHLNYTCGAENSTGASQARPHAYYALSYCALILAIVFGNGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVMPWVVYLEVTGGVWNFSR
Target: DRD3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Mouse,Rat. ResearchArea: Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using Dopamine Receptor D3 (DRD3) Rabbit pAb (A14622) at 1:3000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.