CREB5 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A14635
- Bilder (1)
| Artikelname: | CREB5 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A14635 |
| Hersteller Artikelnummer: | A14635 |
| Alternativnummer: | ABB-A14635-20UL,ABB-A14635-100UL,ABB-A14635-500UL,ABB-A14635-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CREB-5, CREBPA, CRE-BPA, CREB5 |
| The product of this gene belongs to the CRE (cAMP response element)-binding protein family. Members of this family contain zinc-finger and bZIP DNA-binding domains. The encoded protein specifically binds to CRE as a homodimer or a heterodimer with c-Jun or CRE-BP1, and functions as a CRE-dependent trans-activator. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 57kDa |
| NCBI: | 9586 |
| UniProt: | Q02930 |
| Reinheit: | Affinity purification |
| Sequenz: | HPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQT |
| Target-Kategorie: | CREB5 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CREB5 Rabbit pAb (A14635) at 1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Produktgarantie und fachkundiger Support
