CREB5 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A14635
- Images (1)
| Article Name: | CREB5 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A14635 |
| Supplier Catalog Number: | A14635 |
| Alternative Catalog Number: | ABB-A14635-20UL,ABB-A14635-100UL,ABB-A14635-500UL,ABB-A14635-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CREB-5, CREBPA, CRE-BPA, CREB5 |
| The product of this gene belongs to the CRE (cAMP response element)-binding protein family. Members of this family contain zinc-finger and bZIP DNA-binding domains. The encoded protein specifically binds to CRE as a homodimer or a heterodimer with c-Jun or CRE-BP1, and functions as a CRE-dependent trans-activator. Alternatively spliced transcript variants encoding different isoforms have been identified. |
| Clonality: | Polyclonal |
| Molecular Weight: | 57kDa |
| NCBI: | 9586 |
| UniProt: | Q02930 |
| Purity: | Affinity purification |
| Sequence: | HPAAMSNGNMNTMGHMMEMMGSRQDQTPHHHMHSHPHQHQTLPPHHPYPHQHQHPAHHPHPQPHHQQNHPHHHSHSHLHAHPAHHQTSPHPPLHTGNQAQVSPATQQMQPTQTIQPPQPTGGRRRRVVDEDPDERRRKFLERNRAAATRCRQKRKVWVMSLEKKAEELTQT |
| Target: | CREB5 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:1000 - 1:5000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Rat. ResearchArea: Epigenetics Nuclear Signaling,Transcription Factors,Neuroscience,Neurodegenerative Diseases. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using CREB5 Rabbit pAb (A14635) at 1:3000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 30s. |
Product Guarantee and Expert Support
