HTRA3 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14649
Artikelname: HTRA3 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14649
Hersteller Artikelnummer: A14649
Alternativnummer: ABB-A14649-20UL,ABB-A14649-100UL,ABB-A14649-1000UL,ABB-A14649-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: Prsp, Tasp, HTRA3
Enables endopeptidase activity, identical protein binding activity, and serine-type peptidase activity. Involved in proteolysis. Predicted to be located in extracellular region.
Klonalität: Polyclonal
Molekulargewicht: 49kDa
NCBI: 94031
UniProt: P83110
Reinheit: Affinity purification
Sequenz: SDRITRFLTEFQDKQIKDWKKRFIGIRMRTITPSLVDELKASNPDFPEVSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSELQEAVLTESPLLLEVRRGNDDLLFSIAPEVVM
Target-Kategorie: HTRA3
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience,Calcium Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using HTRA3 Rabbit pAb (A14649) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.