HTRA3 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14649
Article Name: HTRA3 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14649
Supplier Catalog Number: A14649
Alternative Catalog Number: ABB-A14649-20UL,ABB-A14649-100UL,ABB-A14649-1000UL,ABB-A14649-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: Prsp, Tasp, HTRA3
Enables endopeptidase activity, identical protein binding activity, and serine-type peptidase activity. Involved in proteolysis. Predicted to be located in extracellular region.
Clonality: Polyclonal
Molecular Weight: 49kDa
NCBI: 94031
UniProt: P83110
Purity: Affinity purification
Sequence: SDRITRFLTEFQDKQIKDWKKRFIGIRMRTITPSLVDELKASNPDFPEVSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSELQEAVLTESPLLLEVRRGNDDLLFSIAPEVVM
Target: HTRA3
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:1000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Neuroscience,Calcium Signaling. Shipping: Ice Bag
Western blot analysis of various lysates using HTRA3 Rabbit pAb (A14649) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 180s.