EPHB6 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14728
Artikelname: EPHB6 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14728
Hersteller Artikelnummer: A14728
Alternativnummer: ABB-A14728-100UL,ABB-A14728-20UL,ABB-A14728-500UL,ABB-A14728-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HEP, EPHB6
This gene encodes a member of a family of transmembrane proteins that function as receptors for ephrin-B family proteins. Unlike other members of this family, the encoded protein does not contain a functional kinase domain. Activity of this protein can influence cell adhesion and migration. Expression of this gene is downregulated during tumor progression, suggesting that the protein may suppress tumor invasion and metastasis. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 111kDa
NCBI: 2051
UniProt: O15197
Reinheit: Affinity purification
Sequenz: HFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV
Target-Kategorie: EPHB6
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Kinase,Tyrosine kinases,Neuroscience, Cell Type Marker,Neuron marker. Shipping: Ice Bag
Western blot analysis of various lysates using EPHB6 Rabbit pAb (A14728) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.