EPHB6 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14728
Article Name: EPHB6 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14728
Supplier Catalog Number: A14728
Alternative Catalog Number: ABB-A14728-100UL,ABB-A14728-20UL,ABB-A14728-500UL,ABB-A14728-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HEP, EPHB6
This gene encodes a member of a family of transmembrane proteins that function as receptors for ephrin-B family proteins. Unlike other members of this family, the encoded protein does not contain a functional kinase domain. Activity of this protein can influence cell adhesion and migration. Expression of this gene is downregulated during tumor progression, suggesting that the protein may suppress tumor invasion and metastasis. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 111kDa
NCBI: 2051
UniProt: O15197
Purity: Affinity purification
Sequence: HFDQLVAAFDKMIRKPDTLQAGGDPGERPSQALLTPVALDFPCLDSPQAWLSAIGLECYQDNFSKFGLCTFSDVAQLSLEDLPALGITLAGHQKKLLHHIQLLQQHLRQQGSVEV
Target: EPHB6
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. ResearchArea: Signal Transduction,Kinase,Tyrosine kinases,Neuroscience, Cell Type Marker,Neuron marker. Shipping: Ice Bag
Western blot analysis of various lysates using EPHB6 Rabbit pAb (A14728) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 30s.