GNAZ Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14737
Artikelname: GNAZ Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14737
Hersteller Artikelnummer: A14737
Alternativnummer: ABB-A14737-20UL,ABB-A14737-100UL,ABB-A14737-1000UL,ABB-A14737-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: HG1H, gz-alpha, GNAZ
The protein encoded by this gene is a member of a G protein subfamily that mediates signal transduction in pertussis toxin-insensitive systms. This encoded protein may play a role in maintaining the ionic balance of perilymphatic and endolymphatic cochlear fluids.
Klonalität: Polyclonal
Molekulargewicht: 41kDa
NCBI: 2781
UniProt: P19086
Reinheit: Affinity purification
Sequenz: LFDSICNNNWFINTSLILFLNKKDLLAEKIRRIPLTICFPEYKGQNTYEEAAVYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAVTDVIIQNNLK
Target-Kategorie: GNAZ
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Signal Transduction,G protein signaling,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,Cell Biology Developmental Biology,Microtubules. Shipping: Ice Bag
Western blot analysis of various lysates using GNAZ Rabbit pAb (A14737) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.