GNAZ Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14737
Article Name: GNAZ Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14737
Supplier Catalog Number: A14737
Alternative Catalog Number: ABB-A14737-20UL,ABB-A14737-100UL,ABB-A14737-1000UL,ABB-A14737-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: HG1H, gz-alpha, GNAZ
The protein encoded by this gene is a member of a G protein subfamily that mediates signal transduction in pertussis toxin-insensitive systms. This encoded protein may play a role in maintaining the ionic balance of perilymphatic and endolymphatic cochlear fluids.
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 2781
UniProt: P19086
Purity: Affinity purification
Sequence: LFDSICNNNWFINTSLILFLNKKDLLAEKIRRIPLTICFPEYKGQNTYEEAAVYIQRQFEDLNRNKETKEIYSHFTCATDTSNIQFVFDAVTDVIIQNNLK
Target: GNAZ
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Epigenetics Nuclear Signaling,Translation Control,Regulation of eIF4 and p70 S6 Kinase,Signal Transduction,G protein signaling,PI3K-Akt Signaling Pathway,mTOR Signaling Pathway,Cell Biology Developmental Biology,Microtubules. Shipping: Ice Bag
Western blot analysis of various lysates using GNAZ Rabbit pAb (A14737) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.