Cytokeratin 12 (KRT12) Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A14746
- Bilder (1)
| Artikelname: | Cytokeratin 12 (KRT12) Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A14746 |
| Hersteller Artikelnummer: | A14746 |
| Alternativnummer: | ABB-A14746-100UL,ABB-A14746-20UL,ABB-A14746-1000UL,ABB-A14746-500UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | K12, MECD1, Cytokeratin 12 (KRT12) |
| KRT12 encodes the type I intermediate filament chain keratin 12, expressed in corneal epithelia. Mutations in this gene lead to Meesmann corneal dystrophy. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 54kDa |
| NCBI: | 3859 |
| UniProt: | Q99456 |
| Reinheit: | Affinity purification |
| Sequenz: | TRLLNDMRAQYETIAEQNRKDAEAWFIEKSGELRKEISTNTEQLQSSKSEVTDLRRAFQNLEIELQSQLAMKKSLEDSLAEAEGDYCAQLSQVQQLISNLEAQLLQVRADAERQNVDHQRLLNVKARLELEIETYRRLLDGEAQGDGLEESLFVTDSKSQAQSTDSSKDPTKTRKIKTVVQEMVNGEVVSSQVQEIEELM |
| Target-Kategorie: | KRT12 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Intermediate Filaments,Neuroscience, Cell Type Marker. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using Cytokeratin 12 (KRT12) Rabbit pAb (A14746) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Produktgarantie und fachkundiger Support
