Cytokeratin 12 (KRT12) Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A14746
- Images (1)
| Article Name: | Cytokeratin 12 (KRT12) Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A14746 |
| Supplier Catalog Number: | A14746 |
| Alternative Catalog Number: | ABB-A14746-100UL,ABB-A14746-20UL,ABB-A14746-1000UL,ABB-A14746-500UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | K12, MECD1, Cytokeratin 12 (KRT12) |
| KRT12 encodes the type I intermediate filament chain keratin 12, expressed in corneal epithelia. Mutations in this gene lead to Meesmann corneal dystrophy. |
| Clonality: | Polyclonal |
| Molecular Weight: | 54kDa |
| NCBI: | 3859 |
| UniProt: | Q99456 |
| Purity: | Affinity purification |
| Sequence: | TRLLNDMRAQYETIAEQNRKDAEAWFIEKSGELRKEISTNTEQLQSSKSEVTDLRRAFQNLEIELQSQLAMKKSLEDSLAEAEGDYCAQLSQVQQLISNLEAQLLQVRADAERQNVDHQRLLNVKARLELEIETYRRLLDGEAQGDGLEESLFVTDSKSQAQSTDSSKDPTKTRKIKTVVQEMVNGEVVSSQVQEIEELM |
| Target: | KRT12 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Mouse,Rat. ResearchArea: Signal Transduction,Cell Biology Developmental Biology,Cytoskeleton,Intermediate Filaments,Neuroscience, Cell Type Marker. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using Cytokeratin 12 (KRT12) Rabbit pAb (A14746) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 1s. |
Product Guarantee and Expert Support
