UNC5C Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14809
Artikelname: UNC5C Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14809
Hersteller Artikelnummer: A14809
Alternativnummer: ABB-A14809-100UL,ABB-A14809-20UL,ABB-A14809-1000UL,ABB-A14809-500UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: UNC5H3, UNC5C
This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin, they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.
Klonalität: Polyclonal
Molekulargewicht: 103kDa
NCBI: 8633
UniProt: O95185
Reinheit: Affinity purification
Sequenz: EGQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWRRRECTAPAPKNGGKDCDGLVLQSK
Target-Kategorie: UNC5C
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using UNC5C Rabbit pAb (A14809) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.