UNC5C Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14809
Article Name: UNC5C Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14809
Supplier Catalog Number: A14809
Alternative Catalog Number: ABB-A14809-100UL,ABB-A14809-20UL,ABB-A14809-1000UL,ABB-A14809-500UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: UNC5H3, UNC5C
This gene product belongs to the UNC-5 family of netrin receptors. Netrins are secreted proteins that direct axon extension and cell migration during neural development. They are bifunctional proteins that act as attractants for some cell types and as repellents for others, and these opposite actions are thought to be mediated by two classes of receptors. The UNC-5 family of receptors mediate the repellent response to netrin, they are transmembrane proteins containing 2 immunoglobulin (Ig)-like domains and 2 type I thrombospondin motifs in the extracellular region.
Clonality: Polyclonal
Molecular Weight: 103kDa
NCBI: 8633
UniProt: O95185
Purity: Affinity purification
Sequence: EGQSVQKIACTTLCPVDGRWTPWSKWSTCGTECTHWRRRECTAPAPKNGGKDCDGLVLQSK
Target: UNC5C
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cell Biology Developmental Biology,Apoptosis,Neuroscience. Shipping: Ice Bag
Western blot analysis of various lysates using UNC5C Rabbit pAb (A14809) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.