SLC4A8 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14825
Artikelname: SLC4A8 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14825
Hersteller Artikelnummer: A14825
Alternativnummer: ABB-A14825-100UL,ABB-A14825-20UL,ABB-A14825-500UL,ABB-A14825-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, WB
Spezies Reaktivität: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: NBC3, NDCBE, SLC4A8
The protein encoded by this gene is a membrane protein that functions to transport sodium and bicarbonate ions across the cell membrane. The encoded protein is important for pH regulation in neurons. The activity of this protein can be inhibited by 4,4-Di-isothiocyanatostilbene-2,2-disulfonic acid (DIDS). Several transcript variants encoding different isoforms have been found for this gene.
Klonalität: Polyclonal
Molekulargewicht: 123kDa
NCBI: 9498
UniProt: Q2Y0W8
Reinheit: Affinity purification
Sequenz: MPAAGSNEPDGVLSYQRPDEEAVVDQGGTSTILNIHYEKEELEGHRTLYVGVRMPLGRQSHRHHRTHGQKHRRRGRGKGASQGEEGLEAL
Target-Kategorie: SLC4A8
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using SLC4A8 Rabbit pAb (A14825) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.