SLC4A8 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14825
Article Name: SLC4A8 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14825
Supplier Catalog Number: A14825
Alternative Catalog Number: ABB-A14825-100UL,ABB-A14825-20UL,ABB-A14825-500UL,ABB-A14825-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, WB
Species Reactivity: Human
Immunogen: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: NBC3, NDCBE, SLC4A8
The protein encoded by this gene is a membrane protein that functions to transport sodium and bicarbonate ions across the cell membrane. The encoded protein is important for pH regulation in neurons. The activity of this protein can be inhibited by 4,4-Di-isothiocyanatostilbene-2,2-disulfonic acid (DIDS). Several transcript variants encoding different isoforms have been found for this gene.
Clonality: Polyclonal
Molecular Weight: 123kDa
NCBI: 9498
UniProt: Q2Y0W8
Purity: Affinity purification
Sequence: MPAAGSNEPDGVLSYQRPDEEAVVDQGGTSTILNIHYEKEELEGHRTLYVGVRMPLGRQSHRHHRTHGQKHRRRGRGKGASQGEEGLEAL
Target: SLC4A8
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse,Rat. ResearchArea: Cancer,Signal Transduction,Endocrine Metabolism. Shipping: Ice Bag
Western blot analysis of various lysates using SLC4A8 Rabbit pAb (A14825) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.