ELMO1 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer:
ABB-A14830
- Bilder (1)
| Artikelname: | ELMO1 Rabbit pAb, Unconjugated, Polyclonal |
| Artikelnummer: | ABB-A14830 |
| Hersteller Artikelnummer: | A14830 |
| Alternativnummer: | ABB-A14830-20UL,ABB-A14830-100UL,ABB-A14830-500UL,ABB-A14830-1000UL |
| Hersteller: | ABclonal |
| Wirt: | Rabbit |
| Kategorie: | Antikörper |
| Applikation: | ELISA, WB |
| Spezies Reaktivität: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Konjugation: | Unconjugated |
| Alternative Synonym: | CED12, CED-12, ELMO-1, ELMO1 |
| This gene encodes a member of the engulfment and cell motility protein family. These proteins interact with dedicator of cytokinesis proteins to promote phagocytosis and cell migration. Increased expression of this gene and dedicator of cytokinesis 1 may promote glioma cell invasion, and single nucleotide polymorphisms in this gene may be associated with diabetic nephropathy. Alternative splicing results in multiple transcript variants. |
| Klonalität: | Polyclonal |
| Molekulargewicht: | 84kDa |
| NCBI: | 9844 |
| UniProt: | Q92556 |
| Reinheit: | Affinity purification |
| Sequenz: | DFQSRPILELKEKIQPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMKEKGALKQNKEVLELAFSILYDSNCQLNFIAPDKHEYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNYDFVYDCN |
| Target-Kategorie: | ELMO1 |
| Antibody Type: | Primary Antibody |
| Application Verdünnung: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Anwendungsbeschreibung: | Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Apoptosis,Cytoskeleton,Extracellular Matrix,Endocrine Metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ELMO1 Rabbit pAb (A14830) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Produktgarantie und fachkundiger Support
