ELMO1 Rabbit pAb, Unconjugated, Polyclonal
Catalog Number:
ABB-A14830
- Images (1)
| Article Name: | ELMO1 Rabbit pAb, Unconjugated, Polyclonal |
| Biozol Catalog Number: | ABB-A14830 |
| Supplier Catalog Number: | A14830 |
| Alternative Catalog Number: | ABB-A14830-20UL,ABB-A14830-100UL,ABB-A14830-500UL,ABB-A14830-1000UL |
| Manufacturer: | ABclonal |
| Host: | Rabbit |
| Category: | Antikörper |
| Application: | ELISA, WB |
| Species Reactivity: | Human |
| Immunogen: | Recombinant protein (or fragment).This information is considered to be commercially sensitive. |
| Conjugation: | Unconjugated |
| Alternative Names: | CED12, CED-12, ELMO-1, ELMO1 |
| This gene encodes a member of the engulfment and cell motility protein family. These proteins interact with dedicator of cytokinesis proteins to promote phagocytosis and cell migration. Increased expression of this gene and dedicator of cytokinesis 1 may promote glioma cell invasion, and single nucleotide polymorphisms in this gene may be associated with diabetic nephropathy. Alternative splicing results in multiple transcript variants. |
| Clonality: | Polyclonal |
| Molecular Weight: | 84kDa |
| NCBI: | 9844 |
| UniProt: | Q92556 |
| Purity: | Affinity purification |
| Sequence: | DFQSRPILELKEKIQPEILELIKQQRLNRLVEGTCFRKLNARRRQDKFWYCRLSPNHKVLHYGDLEESPQGEVPHDSLQDKLPVADIKAVVTGKDCPHMKEKGALKQNKEVLELAFSILYDSNCQLNFIAPDKHEYCIWTDGLNALLGKDMMSDLTRNDLDTLLSMEIKLRLLDLENIQIPDAPPPIPKEPSNYDFVYDCN |
| Target: | ELMO1 |
| Antibody Type: | Primary Antibody |
| Application Dilute: | WB,1:500 - 1:2000|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements. |
| Application Notes: | Cross-Reactivity: Human,Mouse. ResearchArea: Cancer,Invasion and Metastasis,Signal Transduction,G protein signaling,Small G proteins,Cell Biology Developmental Biology,Apoptosis,Cytoskeleton,Extracellular Matrix,Endocrine Metabolism. Shipping: Ice Bag |
|
|
Western blot analysis of various lysates using ELMO1 Rabbit pAb (A14830) at 1:1000 dilution. Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution. Lysates/proteins: 25µg per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit (RM00020). Exposure time: 60s. |
Product Guarantee and Expert Support
