SLC25A17 Rabbit pAb, Unconjugated, Polyclonal

Artikelnummer: ABB-A14840
Artikelname: SLC25A17 Rabbit pAb, Unconjugated, Polyclonal
Artikelnummer: ABB-A14840
Hersteller Artikelnummer: A14840
Alternativnummer: ABB-A14840-20UL,ABB-A14840-100UL,ABB-A14840-500UL,ABB-A14840-1000UL
Hersteller: ABclonal
Wirt: Rabbit
Kategorie: Antikörper
Applikation: ELISA, IF, WB
Spezies Reaktivität: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Konjugation: Unconjugated
Alternative Synonym: PMP34, SLC25A17
This gene encodes a peroxisomal membrane protein that belongs to the family of mitochondrial solute carriers. It is expressed in the liver, and is likely involved in transport. Alternative splicing results in multiple transcript variants.
Klonalität: Polyclonal
Molekulargewicht: 35kDa
NCBI: 10478
UniProt: O43808
Reinheit: Affinity purification
Sequenz: IDAFHQIIRDEGISALWNGTFPSLLLVFNPAIQFMFYEGLKRQLLKKRMKLSSLDVFIIGAVAKAIATTVTYPLQTVQSILRFGRHRLNPENRTLGSLRNI
Target-Kategorie: SLC25A17
Antibody Type: Primary Antibody
Application Verdünnung: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Anwendungsbeschreibung: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag
Western blot analysis of various lysates using SLC25A17 Rabbit pAb (A14840) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.