SLC25A17 Rabbit pAb, Unconjugated, Polyclonal

Catalog Number: ABB-A14840
Article Name: SLC25A17 Rabbit pAb, Unconjugated, Polyclonal
Biozol Catalog Number: ABB-A14840
Supplier Catalog Number: A14840
Alternative Catalog Number: ABB-A14840-20UL,ABB-A14840-100UL,ABB-A14840-500UL,ABB-A14840-1000UL
Manufacturer: ABclonal
Host: Rabbit
Category: Antikörper
Application: ELISA, IF, WB
Species Reactivity: Human
Immunogen: Synthetic peptide. This information is considered to be commercially sensitive.
Conjugation: Unconjugated
Alternative Names: PMP34, SLC25A17
This gene encodes a peroxisomal membrane protein that belongs to the family of mitochondrial solute carriers. It is expressed in the liver, and is likely involved in transport. Alternative splicing results in multiple transcript variants.
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 10478
UniProt: O43808
Purity: Affinity purification
Sequence: IDAFHQIIRDEGISALWNGTFPSLLLVFNPAIQFMFYEGLKRQLLKKRMKLSSLDVFIIGAVAKAIATTVTYPLQTVQSILRFGRHRLNPENRTLGSLRNI
Target: SLC25A17
Antibody Type: Primary Antibody
Application Dilute: WB,1:500 - 1:2000|IF/ICC,1:50 - 1:200|ELISA,Recommended starting concentration is 1 µg/mL. Please optimize the concentration based on your specific assay requirements.
Application Notes: Cross-Reactivity: Human,Mouse. Shipping: Ice Bag
Western blot analysis of various lysates using SLC25A17 Rabbit pAb (A14840) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25µg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.